DPCstruct | MC56787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 125 ± 25 aa |
| Standard deviation of domain lengths | 24.60 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.84 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0236- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8PJ11 | 15-167 | RAAYCAHGYVYDRCDFAQSTPRVRRWTGLRQDSGDPKLFAPRVKEFYEALGVDPKEKLLVYSDALNVEKAVGLWDQCRGLGLEKVSF… |
| A0A1V5G4V7 | 188-335 | GTVLTDTYTTDVFLRNFSKKHAALFTSLRQDSGDPFLFTDKVIKRYEELKVNPKLKYIVFSDSLNVDKAIEIKNYCGDRIGATFGIG… |
| X1RSR2 | 28-139 | None |
| U6LZW3 | 49-126 | None |
| A0A3A9T134 | 449-587 | None |
| A0A536S7S4 | 35-179 | None |
| A0A284QUE2 | 260-417 | None |
| A0A843GI89 | 296-439 | None |
| A0A645BUW1 | 12-129 | None |
| A0A3Q0F9C7 | 22-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.