DPCstruct | MC56776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 91 ± 5 aa |
| Standard deviation of domain lengths | 4.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8J1L7 | 1-94 | MLVKSGISFTSPAGARKNLSYDIPGWDFDEVRKRGRALSDDALNSIEIEGASDDERKIFYTAMYHAMIDPRIIADVDGNYTGADGKI… |
| A0A6I3RKG2 | 16-106 | VIVKTAISSVSTNGAKNNMAELAGLAFDDLKAKGEALWEKELGKYTLTADRKTKRTFYTSAYHAALHPFIFQDADGQFRGLDKNIEK… |
| A0A090WXR0 | 44-137 | None |
| A0A0J8SNS9 | 67-146 | None |
| A0A0B7ICR5 | 22-114 | None |
| T1A6D9 | 1-90 | None |
| A0A014NTL5 | 10-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.