DPCstruct | MC56772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Standard deviation of domain lengths | 9.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2F805 | 8-75 | NGIDREYDLSMTEVNAFINWYEERANGVGTAMYGINKYNNNKGPFVNRKDYVFYDKIITFEVNSYDTG |
| A0A1S8LNF6 | 111-187 | TIPAANRNTTLSLSMKNSTIRKYSLTQDELNKFNHWYNLRANGGTLQSYYIFNIPATKYSPDRKDYVLFNNISSLEI |
| W4ASX3 | 140-221 | None |
| A0A1R0YLB9 | 321-393 | None |
| A0A5C4SVN6 | 71-136 | None |
| A0A7H1VNY6 | 349-423 | None |
| A0A1G9VPE1 | 1-58 | None |
| A0A2N9ZLE0 | 117-187 | None |
| A0A7U5KID3 | 1-59 | None |
| A0A5S9MI65 | 175-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.