DPCstruct | MC56770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 456 ± 127 aa |
| Standard deviation of domain lengths | 127.12 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 69.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6LA03 | 54-345 | FEFYKNPFGASVGSSELTAQVGSLSAITFPVAELENCTDENECRKYCNDMKHVRECVAFAEKHNLMSPADIAHARKFADVAGETPGG… |
| A0A3A4VAR7 | 1-461 | MTKTIALGTFLTGIVLLAGVAFAQEPNITFPIAELGGCNSKEECKTYCDTPGNALSCVSFAEARGLMTTEEAATARKFAGQTGPGGC… |
| A0A554IMB7 | 5-381 | None |
| A0A1G2VJU7 | 6-764 | None |
| A0A831V501 | 3-498 | None |
| A0A7T5RHD9 | 539-914 | None |
| A0A1G2U761 | 10-358 | None |
| A0A1G2IWL3 | 18-485 | None |
| A0A0G0Q9K5 | 47-481 | None |
| A0A7T5RJS7 | 6-711 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.