DPCstruct | MC5677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 158 ± 20 aa |
| Standard deviation of domain lengths | 20.25 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655AQ98 | 1-139 | MLVLHGFWSNSGGMRLWAEDSDLLVKSPSQALRSARPHPFAAPADLIAGIHPGKPATAVLLLPSLRSAPLDSPELIRLAPRPAARTD… |
| T2ISH8 | 1-199 | MKILHGTWIPQTTNEFKNGGGFFLWVETDSLLKGRRKTKQHRHPRQLLSDELQTFFEQKLGVGKNNTNNKPSTQTKYFILPSTPDSP… |
| A0A0F4J1Y2 | 1-171 | None |
| D2Z6H0 | 1-147 | None |
| T2JW42 | 1-172 | None |
| A0A284VIJ0 | 1-171 | None |
| A0A7Y8LN34 | 1-127 | None |
| A0A402ABT3 | 1-133 | None |
| A0A3M9Z5Y9 | 1-181 | None |
| A0A1Q9TZ28 | 20-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.