DPCstruct | MC56769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 4.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4V4H3 | 1-66 | MPVPPKRRPNSSKKRRASHFALRAKNLIKCKNCGKPSLAHQTCPSCGTYQGRQVLKIKVKNDKTKS |
| A0A3D4HW20 | 2-67 | AAQPKKKISRVRGRTRRAHQARKFSKLPTCPQCHQPKPGHIICPECGYYAGKKLLHTKTDQRIGKQ |
| A0A023DXB4 | 8-68 | None |
| A0A259N616 | 159-219 | None |
| A0A1G2V9K1 | 3-52 | None |
| E6YX16 | 22-81 | None |
| A0A2M6USJ9 | 1-68 | None |
| A0A7C1PUB9 | 1-57 | None |
| A0A225X5I6 | 109-167 | None |
| X1AS75 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.