DPCstruct | MC5676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 55 ± 7 aa |
| Standard deviation of domain lengths | 6.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A127NSK5 | 9-63 | PNRNHPMYCPYCGGMNLFPDEEGDFAWKCCECLRIFSVMFHGQDDAPVAPAKTVS |
| A0A4V1RKE1 | 20-69 | MSERAQPFHCPYCGDENLFPREGAGAWECRSCLRSFTVQMTGMIPHPGGA |
| A0A7W1B435 | 2-49 | None |
| A0A810NGG2 | 6-64 | None |
| A0A7W4CXT4 | 2-53 | None |
| A0A1M7IMA6 | 1-55 | None |
| A0A318RTZ6 | 21-73 | None |
| A0A2N6SWW2 | 13-66 | None |
| A0A2X3KQ67 | 1-66 | None |
| A0A2N6TCZ9 | 13-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.