DPCstruct | MC56756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 301 ± 63 aa |
| Standard deviation of domain lengths | 63.34 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 31.92 |
| Pfam Score | 76.93 |
| Assigned Pfam label(s) | PF04990- PF04992- PF04998- PF05000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H0L1 | 44-226 | MIACVGQQAINGKRVPNGFENRALPHFEKFSKIPASRGFVENSFFSGLTPTEFFFHTMAGREGLVDTAVKTAETGYLQRRLVKCLED… |
| A0A7I8J9I0 | 4-354 | CVGQQNVEGKRIPFGFIGRTLPHFTKDDYGPESRGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTSETGYIQRRLVKAMEDIMV… |
| A0A821S139 | 307-701 | None |
| A0A2H2IYM4 | 522-780 | None |
| A0A6A4GUT0 | 148-496 | None |
| A0A7C5X2T1 | 2-260 | None |
| A0A815HE76 | 8-333 | None |
| A0A2G3CZT3 | 346-602 | None |
| A0A819MJ77 | 2-375 | None |
| A0A086JWA6 | 20-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.