DPCstruct | MC56753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 298 ± 59 aa |
| Standard deviation of domain lengths | 58.76 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H3CLQ5 | 8-321 | LDEIDIDIQTRPGKNKDACGVSLEISGLRDTWTKRQFELLVRELRRLTSPIKYREDDFQVFLDLSGFQKDVHGFDGQSLVSGVFGAI… |
| A0A1X3J8X1 | 255-521 | IAQLSTDAGSEAQGAEVRAKERFLQTLNSFVNPFKREGEEQITDFNTSVVAWNGNLQRFIIDEVRNFDISNFDQLEHIVEGSIDESG… |
| A0A381H3I8 | 1-181 | None |
| A0A6F8PTB5 | 400-758 | None |
| A0A532DH99 | 188-436 | None |
| A0A1G6TG90 | 268-657 | None |
| A0A193SLS8 | 27-343 | None |
| A0A220MIQ2 | 393-775 | None |
| A0A524Q9S5 | 23-310 | None |
| A0A6B0Z363 | 222-544 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.