DPCstruct | MC5675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 136 ± 10 aa |
| Standard deviation of domain lengths | 9.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2RTA9 | 6-123 | GTPYGGEFGITVELGSVWGRRGIAPAVKTLLDGFISALHVHDLSSREHVAAALDEVGDGERLWELLNDPAMAILGPRRLVRPHGRGI… |
| A0A1F6H593 | 111-257 | RGEIKPHSIWCAMKNGFVEVNNDHPSLYGIQIKVKAPIGTTINLASIVKPVLDGIISSFHTHNGSDIIELSERLAKLLGENEQTMEK… |
| A0A1Q8XX86 | 269-415 | None |
| A0A3D5DWK8 | 74-200 | None |
| A0A064CER7 | 91-225 | None |
| A0A2W6CHR5 | 18-146 | None |
| A0A7C5KT33 | 2-138 | None |
| A0A329LH02 | 538-668 | None |
| A6WG99 | 190-337 | None |
| A0A2T0QIM0 | 126-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.