DPCstruct | MC5674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 86 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6CCS3 | 3-75 | DADIAAALMALARARAPGTFCPSEAARALSEDWRPLMGVVRRVAATLPLLATQGGVPVDPAGARGPIRLALDE |
| A0A4Q2RQG1 | 88-171 | RRVSDSDQRLEAAILDLLARRAPTATICPSDAAREVGDADGWRELMEPARRAAARLVARGEVEITQGGQVVDLATAKGPIRIRR |
| A0A7W6LX13 | 6-97 | None |
| A0A2W5PTQ8 | 5-87 | None |
| A0A4V5N8B9 | 57-156 | None |
| A0A4U0VW53 | 13-118 | None |
| A0A3M0BZ78 | 9-91 | None |
| A0A433ASE0 | 64-146 | None |
| A0A0F2R8G5 | 7-99 | None |
| A0A1G6PHS6 | 3-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.