DPCstruct | MC56737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 63 ± 9 aa |
| Standard deviation of domain lengths | 9.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174MXN3 | 1-53 | MDGGKCIFMLRGVRPFLSDKYDLTRHPNYRYTADADPKNVFDMERYMKKQRAV |
| G5GG05 | 1-48 | MDGGKCILEIREARPFYSDKFDITKHKNYKMLSDYNKKNAGFQDRKAL |
| A0A174C3Q3 | 1-71 | None |
| A0A396LUQ5 | 24-95 | None |
| U2RVF4 | 9-54 | None |
| R9KME6 | 21-88 | None |
| W7UN41 | 117-187 | None |
| K1RLZ5 | 36-101 | None |
| A0A1Y3XJA1 | 1-61 | None |
| A0A7U9WT40 | 86-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.