DPCstruct | MC56733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 196 ± 26 aa |
| Standard deviation of domain lengths | 26.49 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 19.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9JMH0 | 16-216 | CPTKDIFCIKSSSWETPDGNDKPWQVAIPNLSLTAPSNIPIKNIAFEFDPTWDTDLPGTYYDLMSENSARGFLSRFCYNAFLNNSRE… |
| A0A395MPG5 | 137-274 | NIALEFNESWLDDLPGTVSHAKRENSAQGYFAYLYSKSSRKGLSFDGLWIIDKEAFWFDKDSQDHDTVYRDFDAEYVEVQWSDAVHY… |
| A0A2K0VW92 | 13-192 | None |
| A0A2H3G9T5 | 4-175 | None |
| A0A366RL43 | 1-189 | None |
| A0A0J9VDA8 | 117-308 | None |
| A0A0F8A1U7 | 94-289 | None |
| L2FKV9 | 31-254 | None |
| A0A5Q3GDI1 | 512-747 | None |
| W9JMH4 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.