DPCstruct | MC56732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 338 ± 50 aa |
| Standard deviation of domain lengths | 49.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 66.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15456 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9J8Y2 | 1-318 | MEPNAAYLNLRNGSYTPPTITTEVGNASRGHRRGDLESSGTMGRGLPREGSGLGTNNDPFVQRPESRRGKSLEQKAFEPLPIGLKQA… |
| A0A1S8BBH9 | 2-284 | GYSNSNEPPTNTTPITGIPECASPERTVRGRDTSRGHHRKRSEQSIMDRGRPIARTTRERKASASASASAPSSSEKEGADTWKLPKG… |
| A0A425BTB1 | 267-577 | None |
| A0A194X793 | 42-379 | None |
| A0A4Q9NZ08 | 145-607 | None |
| A0A6A6YIZ1 | 73-391 | None |
| A0A2S6C732 | 1-292 | None |
| A0A0B7KG16 | 4-319 | None |
| A0A1B8C5N8 | 1-320 | None |
| A0A1U7LTN6 | 321-707 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.