DPCstruct | MC5673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 4.52 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 38.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5F8J9 | 1-93 | MINFNGLLVGFAVFLLIGIFHPIVIKAEYFWGVRSWWIFFIIGSIAAVVSLFVEKEIPSILLGVFAFSCFWSIREIFQQKRRVEKGW… |
| A0A7C3CAI2 | 2-87 | NLQWAGVVLALVTFVTIGLGHVMVRRFHAQWGTRPAIPFFALSVVVLAAAFASASDLLSAVFGITAITLFWDGVEIFRQEKRMRHS |
| A0A2G6PDA5 | 60-159 | None |
| A0A1I0BFJ4 | 1-96 | None |
| R7DI70 | 22-120 | None |
| A0A7V2LW84 | 1-95 | None |
| A0A4V2HXX7 | 13-105 | None |
| R5YIU7 | 11-103 | None |
| A0A847L9B8 | 8-93 | None |
| A0A7J3VE31 | 20-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.