DPCstruct | MC56727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 161 ± 20 aa |
| Standard deviation of domain lengths | 19.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11991 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4UZW9 | 111-285 | ASPRLLSCDLIDPSKSRVKIYILELNVTLEAMEDLWTLGGRLNDAATLAGLEMVRELWDLVKLPPGLRDYPEPFLQLGTIPDEQLPL… |
| G2YCE9 | 14-162 | TPRASFDSVVDILSMGGKRAGFEKNFQELKDLWRLTFDLPVGFSTSEDLPLREHGTSGMCYHFEIHQANALPDVKLYIPTKHYGQSD… |
| A0A6G1M0X8 | 91-258 | None |
| M1W0Y4 | 107-268 | None |
| W6YAE9 | 4-162 | None |
| A0A2H4SQ07 | 553-723 | None |
| C4JZR2 | 207-340 | None |
| A0A229Y169 | 200-374 | None |
| A0A317V723 | 254-417 | None |
| Q5BAT5 | 262-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.