DPCstruct | MC56715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 235 ± 51 aa |
| Standard deviation of domain lengths | 51.17 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V8V7B5 | 26-250 | LNAELLQQDMSEETGYVPKRPIAWEKHFSLPAVMHTLVKAALKGTGIEYQEVMVILKSPLFNDSTDIANEPESVESKSGVVYRLILP… |
| A0A7U2EVH4 | 18-207 | EPLVYMEELFQQLLHGCAIKIQEVGIKLKPVPRKTTAVFIDGTVRTNWPDNIHEVLRVTSTKSGKTWYIDISGGQYGITRTFWTAKE… |
| A0A420MJN1 | 1-168 | None |
| A0A6A5UD55 | 2-232 | None |
| A0A3M7MFQ2 | 9-171 | None |
| A0A3M7MFT3 | 40-283 | None |
| A0A6S6W9Q2 | 52-300 | None |
| A0A6A7AHV0 | 13-284 | None |
| A0A3L6NAF1 | 7-244 | None |
| A0A5N6EXL1 | 4-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.