DPCstruct | MC56711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 213 |
|---|---|
| Mean domain length (aa) | 123 ± 19 aa |
| Standard deviation of domain lengths | 18.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.23 |
| Pfam Score | 98.14 |
| Assigned Pfam label(s) | CL0220- CL0036- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9N957 | 3-74 | QDLKVDPEKVTRLSLGEKAYEKATVTHGADIVRFTRRNLLRIFPRSTRITSSNYNPMMGWRYGVQMVAANMQ |
| A0A1V8UP66 | 297-421 | ETQGEQVKKGTIIGALGRLGVYTRSCHFHGFDQPEAKLPTHIFALGEGKLLDLHEESPGQVFKHNLDYLMRAYPKGTRVRSNNLDPA… |
| Q4QBH9 | 362-500 | None |
| E9G2R4 | 265-386 | None |
| A0A814WNX0 | 129-297 | None |
| A0A1I8IMI3 | 112-224 | None |
| A0A1I8IJD4 | 6-104 | None |
| A0A3Q0IYR6 | 365-512 | None |
| A0A7S1UZV9 | 592-720 | None |
| E9G409 | 198-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.