DPCstruct | MC56710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 205 ± 16 aa |
| Standard deviation of domain lengths | 15.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F0HK85 | 15-210 | RSSRELLAVHGLIAVPGDIQKPVDAVCAGWDVDTAARDVQAHLDGERAMANAALPVMIPHPRDLVDLFDLTNSPMTDAEAATRYNLD… |
| A0A4Y3VT71 | 151-346 | AYLARRPEHPLTLPDDVQQLVEAVHGDADALARTDAALYRSHTLHRARTRTEEHHSALHLVPPWHDTLSLSDLHRQNLHPREAATRL… |
| W1V8D7 | 5-210 | None |
| A0A1Q9MSY3 | 2-216 | None |
| A0A827BMV4 | 6-180 | None |
| A0A2G6XUT0 | 73-279 | None |
| A0A3N1Q4W1 | 19-257 | None |
| A0A2G7E1D2 | 1-195 | None |
| A0A2E0ZBF7 | 1039-1261 | None |
| A0A7V8SR02 | 240-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.