DPCstruct | MC5671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 60 ± 8 aa |
| Standard deviation of domain lengths | 7.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2XIU3 | 69-132 | TDKKQAPRHLDVFALLPQTNCRQCGEATCLAFAVNLILGNRLLEECIPLQRDAAYNERRATLEA |
| A0A7V7D8Y7 | 5-58 | NIVEILKLLPKTNCGDCNEATCLVFSTRVAEGVKTTEDCPHIPADAKEKLNRYL |
| A0A1G3R3U3 | 16-81 | None |
| A0A7C4GPA3 | 46-104 | None |
| A0A2N6BLL2 | 1-51 | None |
| A0A7C0ZCR9 | 81-136 | None |
| A0A6L9J358 | 3-56 | None |
| A0A662TYG5 | 2-61 | None |
| A0A1V4QLT1 | 94-147 | None |
| E1YD30 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.