DPCstruct | MC56708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 71 ± 14 aa |
| Standard deviation of domain lengths | 14.11 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4ECT2 | 1-56 | MAALPEKDEWSPEIYQIETSDPVLGGPDGIDNLQAKQLSNRTRWLRDQLQKIAAGV |
| A0A1S9ZXV7 | 1-58 | MALIKETDEWVENIYLIEPNDPVEGGEDGVDNRPHIELANRTAFLNKKRQEQEQKTQE |
| A0A8B2SKL8 | 1-62 | None |
| A0A4R7MXL7 | 1-63 | None |
| A0A378XFX6 | 1-48 | None |
| A0A7U4R125 | 1-60 | None |
| A0A8A7FWV5 | 1-80 | None |
| B6WPZ2 | 1-51 | None |
| B6WPY9 | 1-66 | None |
| B6WUB6 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.