DPCstruct | MC56706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 134 ± 19 aa |
| Standard deviation of domain lengths | 18.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.10 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF00787- PF15904 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RX32 | 5-133 | EELIMSLSAVLRDTGDSVLNGHRQLVLSTTRLQNLNCLLQQLLHPRPLRMHGFLALPVLPTASSPHVLELQFLFDVFQKVPRFKLVH… |
| A0A4W5KXG7 | 27-179 | RFPTAAPKVLSCFLHFHQYEVNGITAALAEELFHKGEQLLVAGEVFTLCPLQLYAITQQLKLAKPTCSNGDAKADLGHILDFTCRLK… |
| A0A5B8MHU3 | 28-148 | None |
| T1HCD2 | 5-122 | None |
| A0A267G9T2 | 117-253 | None |
| A0A7J9GL74 | 3-121 | None |
| A0A5F7ZYS3 | 4-99 | None |
| A0A7M5U417 | 144-273 | None |
| A0A2C9VLM2 | 6-121 | None |
| A0A1J3GQV7 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.