DPCstruct | MC56704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 222 ± 56 aa |
| Standard deviation of domain lengths | 55.51 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.23 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00880 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RVY1 | 31-202 | STLKYKKDYEENKAMGFSIVTDTPERKRTKRAQDQISEVKYHKEWEKMKNVCHLDNTSRDVEHAAKVSKMVSKILYKEKYEDMKEHF… |
| A0A3Q2U3M8 | 2-178 | HVAKMQSDREYKKDYEVTKTKYHTPLDMFSVTAAKKAQEAVTNTGYKQLIHHYTLLPDSVNLELSRNMMQLQSDNMYKADFNNWLRG… |
| A0A3Q3FLS3 | 62-333 | None |
| A0A6P6CN08 | 2-317 | None |
| A0A673AX82 | 141-459 | None |
| A0A437C6S6 | 61-254 | None |
| A0A6I9MZG0 | 49-275 | None |
| A0A6P4YKH0 | 3-306 | None |
| A0A6J0W2A9 | 54-305 | None |
| A0A3Q2NWI8 | 2-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.