DPCstruct | MC56700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 128 ± 24 aa |
| Standard deviation of domain lengths | 23.72 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357N7A7 | 2-97 | LGEVYASKKPVGFEQLDVTPIVSRYLPVGLSRAQVLAAFKGIDSAHVVEQASGALIVRDDRGRAMFDPDARSILMTFRFDGAGMLTG… |
| A0A437MFE5 | 14-137 | ALTTLGIMFLGVAVFAYASGGQSPWPVQAPFDRYIDIGSSQGTWQLERDLARMHPQGSDAPALLSRLRASGMDCMIQPGTTEQYACT… |
| A0A7U5XYY4 | 1-106 | None |
| A0A1G3TGJ9 | 6-141 | None |
| A0A1D7TGR7 | 28-151 | None |
| A0A4S8I143 | 1-141 | None |
| A0A6N0WYS0 | 33-183 | None |
| A0A074MZU0 | 11-133 | None |
| A0A7W6XDR0 | 86-232 | None |
| A0A0D9LNB8 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.