DPCstruct | MC5670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 114 ± 5 aa |
| Standard deviation of domain lengths | 5.06 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 15.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9KQN4 | 281-390 | TILSKSLKSITLDVLKAEVQLTVFKKSPFYEITGELIWNETSLHFKQLQIKNEYFLLHKNGLYLIGNPDLLRVIKFFKSNNEIIVLH… |
| A0A3E0ETA6 | 1-107 | MTPCGFNNETPEICFLWKDKGDYYKLELRLQLGEKIHRLQYYINTAFFAMLSYSPRKYVLLNSVVDSELLTYFQQSQFQLLVLKKHY… |
| A0A2T2VF47 | 417-534 | None |
| A0A7L5E9X3 | 181-301 | None |
| A0A7C1RV94 | 125-231 | None |
| A0A372DZ24 | 133-247 | None |
| A0A1H4HJ11 | 301-417 | None |
| A0A522T6L3 | 307-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.