DPCstruct | MC56693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 168 ± 26 aa |
| Standard deviation of domain lengths | 26.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7AJ34 | 18-170 | RIIRHVLGGSISADGIVVEETMQAGQYRLRRCSPVEILLKRGSISRSQYEAAHQLYHDYALGVVGADDREKGELPPGIQWAGGDPYP… |
| A0A2D4ZNS1 | 2-123 | TLARRRNKDGSYFLTRALVDAGNRFHDDFEIAQTVRPDGFTREDWLRCASGTVLSGGNERQQLLIERVAATLRDLGPELSDISLRCC… |
| A0A433XEV5 | 133-314 | None |
| A0A166DYX2 | 20-156 | None |
| A0A849TMC1 | 97-300 | None |
| A0A3D5UWK5 | 10-148 | None |
| A0A1E4K4G8 | 6-135 | None |
| A0A7R7T6K2 | 8-177 | None |
| A0A7Y8F599 | 60-232 | None |
| A0A327KQ37 | 4-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.