DPCstruct | MC56683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 168 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366GFC2 | 1-165 | MKIFKGILVSSIALTAFNGVGGLLPSEKSEVAYAASYDYSNKQLNSIVHKQVTKQLILKFKNEANLPYQDGIEKFIKEEKQDPELIG… |
| A0A660PVL3 | 4-190 | MKYRLLTIAVLLLFATTSTLAGNLKPRHIPIKPESSSIRVGFDSRHVEVKFIDDADIGLESKGIPSDRSGVLLKTTEARSILAAVSD… |
| A0A0A2DQW2 | 1-169 | None |
| A0A0L0W9K0 | 2-157 | None |
| A0A243LG55 | 1-191 | None |
| A0A357BIX1 | 1-177 | None |
| A0A519JVW7 | 1-174 | None |
| A0A6I4PIM1 | 8-176 | None |
| A0A3D9T3P0 | 1-161 | None |
| A0A0F3IP46 | 11-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.