DPCstruct | MC56676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 121 ± 7 aa |
| Standard deviation of domain lengths | 7.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M8FHG1 | 8-123 | FEQDFDGLIALRSAYESIVKEMEANQLKAHGLAGGNPIKFKGEIRIVPQGVYHIWREMTDSEGKFKWPSDVCAAINRSKVQAEQRKD… |
| A0A177W2H7 | 506-614 | PEQFEKDYIKLKKLKNVYYSISDKIQKNKLKAHGYKGGSKIMFQGKEKIVPKGISKIWKKITDEKGNFKLMDNVDLAFIKSKSQAES… |
| A0A3M8FIK0 | 18-139 | None |
| A0A3M8FHU5 | 4-110 | None |
| A0A0K2E0B8 | 570-691 | None |
| A0A7U4YWK3 | 51-176 | None |
| A0A0K2DUT0 | 350-475 | None |
| A0A177W058 | 267-390 | None |
| A0A177VZI6 | 201-332 | None |
| A0A0K2DYT7 | 556-676 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.