DPCstruct | MC56672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482ZA00 | 1-62 | MAYYHTHGAYDPKYDNEIFSDTYDGRGDIPFAKSHEMDGYLATPSGKIKYYNYVNDTITRLQ |
| A0A017HSV9 | 1-57 | MASYHTHGTYSPYYASEWPTTQDMATDASDDIDGYISTPGGRLWHVDTDTMSVHELC |
| A0A496WR85 | 199-274 | None |
| A0A4Q3ZS59 | 21-76 | None |
| A5FDT5 | 115-178 | None |
| A0A2K8ZYE3 | 229-300 | None |
| A0A5E5Q837 | 8-76 | None |
| A0A1N7QJ07 | 45-119 | None |
| A0A432EG27 | 356-419 | None |
| A0A737EXG6 | 61-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.