DPCstruct | MC5667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 11.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 30.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N0I7Y5 | 132-255 | NETIIANVGRDKDRGARFARVPTGFETCTFCLMLASRGAVYHTRKSAGEWKHFHRGCDCKVVPSFEDDPYAEVVEGVKPRELQERYK… |
| A0A080N2N4 | 1-118 | MIATSTRLTTQRNVRIEPTRPRWVRVPRGSKTCAFCVMLASRGFAYLSEDLAGRQMQYHPDCDCNILPSWGSQILKDYDPDKFAEMH… |
| A0A075UX52 | 120-229 | None |
| A0A229W1N9 | 58-186 | None |
| A0A3A1XN09 | 157-273 | None |
| D1NSM5 | 4-130 | None |
| A0A2S8JAS8 | 209-323 | None |
| A0A1G8KBQ5 | 120-237 | None |
| A0A261EQA3 | 1-119 | None |
| A0A3D1WRI1 | 133-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.