DPCstruct | MC5666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3Z4Q0 | 1-91 | MQEEHIECSIHGQQAMALLCTHLAHSLHHRNPVGFFEYDTGDTGRPDAWCNACEEAWNHTQTESDREQWFINCQHKLVCVGCWDEAK… |
| A0A3D4UTQ9 | 6-90 | EPIYIECGRHGKLIATVVCCHLLKNEGDKVGFVENVSHPNDLQAWCARCEKVFEEEGGMTDIFKEFNGMTIVCVDCYSKSKAYHS |
| A0A4Z0QJE1 | 161-247 | None |
| A0A0Q6ASQ3 | 25-110 | None |
| A0A2V9CNL4 | 5-85 | None |
| A0A0G0JMJ2 | 15-82 | None |
| A0A5S3T7F8 | 1-73 | None |
| A0A5S3YXK6 | 2-79 | None |
| A0A7C1U944 | 268-357 | None |
| A0A380TBQ8 | 30-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.