DPCstruct | MC56658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 181 ± 33 aa |
| Standard deviation of domain lengths | 33.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 12.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L8F453 | 26-193 | EAIAEQVGRLYPVLDNSVTQIQPPAELTETFPVWSLSTDAIDIGNGNLSELAQDTHRWHSQILIDGKPEGVVRSAVSLDGDVSRWAI… |
| A0A7W8M495 | 84-237 | LFAGQKVVDAIAQDITNQDIESWAEVANAAFDLDYVIPVYSTANVTQDSHTILETLVFDDQYIIPVMAKDECIGTATVAQEENKWII… |
| A0A2G3E0L9 | 32-246 | None |
| A0A2W1LCX4 | 37-203 | None |
| A0A2M7HKL3 | 6-188 | None |
| A0A0D0RAF9 | 2-163 | None |
| A0A2N2LBE3 | 10-165 | None |
| A0A2V7W798 | 5-160 | None |
| W7ZIM2 | 4-128 | None |
| R5SDC8 | 7-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.