DPCstruct | MC56653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 106 ± 20 aa |
| Standard deviation of domain lengths | 20.09 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2F9K8 | 21-104 | FDESPFLNNKTVKLIRSFLSENFSKSKSINKTYSSYGLKHIVEYKIGEYISNGELIYSMFMEGFDLKRHNINCYFNIKTSEVKK |
| A0A033V056 | 23-107 | DSPYSINYLPIEKQEQLILWCSNLKPIKSFNQKHSSYGLKHLFEHSEHGFYITNGQLKAALIMTGFKIENIDLLNWHFNISENSV |
| A0A4R4D471 | 98-223 | None |
| A0A849T5G1 | 12-107 | None |
| A0A5P3ML68 | 12-108 | None |
| A0A0C5VDN5 | 68-208 | None |
| A0A2J6WCZ8 | 92-192 | None |
| A0A530A1B1 | 2-89 | None |
| A0A2G7E0G2 | 55-166 | None |
| A0A6P0HXA8 | 148-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.