DPCstruct | MC56652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 123 ± 12 aa |
| Standard deviation of domain lengths | 12.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2F0P3 | 25-143 | QVVMRLLFVYNANSSPMSRMVDFAHKILMPSSYKCPLCAITHHALGERLMWKAFKKQSQFKLDFYYIEEFEKEYILSYNYPVILVEE… |
| A0A399HQU2 | 2-137 | SGTLYFLYNADASIIGKLRYGYRKICQSTEENPACAACDITHGGLSLKETPTWLEAKKVIEADSGYKIVQWHRDELSDEIKDFVESN… |
| A0A3D0I8Q9 | 223-337 | None |
| A0A7W1SQH0 | 1-99 | None |
| A0A5J4Z1V7 | 28-169 | None |
| A0A7Y2A0M3 | 1-98 | None |
| A0A0W8I560 | 3-126 | None |
| A0A7S0G446 | 9-128 | None |
| A0A6I1JVR9 | 35-165 | None |
| A0A849PYN8 | 8-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.