DPCstruct | MC5665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 123 ± 15 aa |
| Standard deviation of domain lengths | 14.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 41.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0HJ75 | 218-341 | LYTGIMTSEDNFRKAVGSNKIKHVEKSKENNFKPQRGDIFVWRKSNGVGHTGIVYKYDKEKDLVTILEAIGKVGSADEKTNKKNGGH… |
| A0A7W3VK83 | 1-159 | GLTKDVAWLTTVDMVSEEAFLKNDSYKKLLNEGCSIEHVDGKDGVFDPNFEPQPGDIFVWRRLKPGRTKEDGHTGIVYTYDKTTKIV… |
| A0A7C3UY51 | 105-218 | None |
| A0A2S8ADX7 | 1-119 | None |
| A0A4Z0FJ01 | 518-647 | None |
| A0A1V4VCE4 | 519-629 | None |
| A0A378S012 | 2-111 | None |
| A0A7D4BCG9 | 106-217 | None |
| A0A8B2BTE4 | 61-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.