DPCstruct | MC5664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 466 ± 34 aa |
| Standard deviation of domain lengths | 33.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380ZWW9 | 397-861 | KTRTPTKVGETKKKEEKGTCVCKQYDLVWGNKVSCEFRKKVVEICAELWGENRKIEMANGLMAVMNVETAGSFKAHHREGYKTANES… |
| A0A2S8AE96 | 2-507 | VTRNAPEQEKGEGKEKCFCNRDFEEKDVRQFVKLLKGSETIWEGQALKGGKRAECNISDKSFTILTKELNNALKKYKINTCAQKMHF… |
| A0A1B9LAW9 | 66-537 | None |
| A0A841N6T5 | 690-1114 | None |
| A0A0X8C306 | 13-426 | None |
| A0A1H7YTM5 | 592-1060 | None |
| A0A1N7QAN5 | 232-742 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.