DPCstruct | MC56638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6CXQ4 | 2-126 | NYRKVTKPAAAMTLSLVLAAGSMTSAMAATANTNKEENIYVNLDDNGSVDGVYVVNSYDLKKDQKITDYGNYSSMTNLSSESKLNEQ… |
| R9IHV6 | 3-106 | ANTDKEEVVYVNLGNDGSVREINVVNIFGGNAEGLIIDYGKYLDVRNMTTTDTIDLSGDAIKINSFAEKLYYEGKLESTRMPWDIQI… |
| D3R2I1 | 28-149 | None |
| A0A372X2L5 | 1-125 | None |
| A0A3D2CMV9 | 13-126 | None |
| A0A352BI57 | 1-132 | None |
| A0A373Q7G6 | 32-146 | None |
| R6RMK6 | 3-135 | None |
| A0A1D9NZ83 | 28-185 | None |
| A0A1Q6MDH2 | 43-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.