DPCstruct | MC56636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 312 ± 48 aa |
| Standard deviation of domain lengths | 48.44 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y3ZTV8 | 3-282 | WTAAARADFYSRDQGSRLIALSWMQALKQKNGQPFLADGLSRYGYLPNPANTANLPVGFHASGPQDFQVVGMTCSACHTRQIEVDGK… |
| A0A2J7U2I8 | 157-450 | VGSLVLLLVLGVVGYATWVNMIREVPQPPEASDEDHFKYAAIGLGIEARIPYYLFAVLPQLCPEKLPRPGGYEVFGFLYENGRDLPV… |
| A0A1Z8A0J1 | 45-272 | None |
| A0A2V9XUR0 | 377-733 | None |
| E8V2G5 | 473-835 | None |
| A0A5B9MAI4 | 9-343 | None |
| A0A1H5P336 | 308-733 | None |
| A0A7X0JNC9 | 1-278 | None |
| A0A2V9ZMN8 | 3-342 | None |
| A0A547Q2M9 | 7-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.