DPCstruct | MC5663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 153 ± 18 aa |
| Standard deviation of domain lengths | 17.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2R7F2 | 27-195 | GFIKFYGLYWRKDLVDWSSKHILGQPKGWLGKGRIAANFDRQKLQMNFWGQKGVYVLYDDALHPVYAGQAGLTRKDSAGGQAIGDRL… |
| A0A6B0W250 | 7-161 | LIQNYGLFWDRDKVDWSKNKATLLGRLKARNEPVDFRRQLGIYALYDREFRLLYVGQAGSGNNTLFSRLKYHGTLHAGTRGLAARWQ… |
| A0A011PAU6 | 95-242 | None |
| A0A517Y0L4 | 1-168 | None |
| A0A7Y4QQB7 | 1-160 | None |
| A0A7V9YN81 | 85-222 | None |
| A0A495A5V9 | 132-282 | None |
| A0A497Y337 | 36-180 | None |
| A0A2Z4Y727 | 6-186 | None |
| A0A3N5Q975 | 2-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.