DPCstruct | MC56626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 333 ± 87 aa |
| Standard deviation of domain lengths | 87.30 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 76.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.09 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0110- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D7B037 | 81-442 | PLPDVEYTYEIDLDNLVFHENYVPCFNLRHMPSTEAKFLEYLRGSDSYGNATCSVNAPVECRWTMALLESPRLCSIDTTTLETYDSL… |
| A0A4Q4VDJ2 | 108-660 | MLHSWRYYIRYHQYDSYFEGLGAKVVASIPPDPKAYQEWLKLMRAEYTARERDLEQHVYEIRDGSSPDYSQFHEFESLPSELPRLDD… |
| A0A1V6S9C2 | 63-404 | None |
| A0A7R7WEU2 | 1-240 | None |
| A0A179GA24 | 712-940 | None |
| A0A370TCP8 | 121-353 | None |
| A0A165T598 | 243-637 | None |
| A0A401GU93 | 562-989 | None |
| A0A4R0RYG9 | 1-307 | None |
| A0A074SR44 | 92-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.