DPCstruct | MC56621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 191 ± 31 aa |
| Standard deviation of domain lengths | 30.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8CE13 | 17-198 | GSSNSKGQEEERRVFYVAMTRAKETLCLIRREKSKNPHLKLLQGDFMLQRPGSFLPDAPRTAMEHSYELLGMQDLFLDYAGRRPRTD… |
| A4BRB0 | 2-106 | LSQSNVDLGHAGCFAAKQPVHRTLSQVSYGDELALVITGERRELRTLQGVVVGKLARKAVLPSGRVTQVTVESVMHWSRLHTDPDHH… |
| A0A260BHV8 | 796-1022 | None |
| A0A829XSB1 | 40-272 | None |
| A0A7C6Y9L4 | 23-209 | None |
| A0A7C1C4U6 | 342-510 | None |
| A0A7G7ENB9 | 40-234 | None |
| A0A410XRG0 | 83-285 | None |
| A0A1W1BBT3 | 67-249 | None |
| A0A418SX56 | 13-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.