DPCstruct | MC5662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 53.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419ISD6 | 27-95 | ILTLYGIIPTFQPPNASFGRVYATYGGIFIILSILWGWQVDKVVPDKFDLIGGFIALIGVAIIMYTPRT |
| A0A7W9DIL4 | 2-68 | ILAAYGIVATWQTANSGRVYATYGGVFIVLALLWAWKADGFKQDKWDIIGASIALIGACIIIYMPRT |
| A0A7Y0L885 | 3-74 | None |
| S7T075 | 50-111 | None |
| D5ADJ3 | 40-114 | None |
| A0A1H7C6K5 | 36-116 | None |
| A0A7C2MFI6 | 2-61 | None |
| A9T501 | 43-121 | None |
| F9CVR0 | 3-75 | None |
| K9Q7H5 | 74-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.