DPCstruct | MC5661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 8.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N4SQ51 | 4-111 | IFWTKEYQEDVGTKDEQGWYDYAYRYYIYWFTFPNRQKIKVRRYTDTPDHCSIFLPEEDLAIKKALDKSPSKNYIFGVVNFLLKKEG… |
| A0A502G705 | 1-85 | MQAVATIEHIREILWNDDGGIAEIYNHLIYRFEESGIIARAYLDDPDKVSIMEVGPVPDSVLAYLKDRFWRIDQIGAQGYRTIWT |
| A0A3M5KQ49 | 2-105 | None |
| A0A519MK20 | 9-111 | None |
| A0A1G4RWR9 | 11-119 | None |
| Q3KAY4 | 53-142 | None |
| A0A6J4LDE3 | 3-109 | None |
| A0A542B9Y6 | 2-117 | None |
| A0A411ZEC3 | 32-129 | None |
| A0A855B9B0 | 11-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.