DPCstruct | MC56605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 97 ± 20 aa |
| Standard deviation of domain lengths | 19.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418YJK6 | 4-114 | EHSCGCPANWKQYNHALKQRGSLTFWMDEQAIAKWNNTERSGRRGRSQAYSDTAIATSLMIKGVFKLLFRALEGSLNSLFRLLKVDL… |
| A0A7C3YJI4 | 1-91 | MDWKIVDERLIRRGELLLSLDFLEGYGNELKSMNDGRVGHPFKLTDRYIEFLIVVRYLFSMSYRQVEGSTRALNRLIRRLPSVDYSW… |
| A0A261KRC8 | 6-98 | None |
| A0A235HDN4 | 3-83 | None |
| F7XBM5 | 18-115 | None |
| A0A7V2HYV2 | 4-98 | None |
| A0A7W1LXT5 | 2-100 | None |
| A9EGP7 | 10-131 | None |
| A0A7C9K402 | 4-83 | None |
| A0A1Y5TS67 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.