DPCstruct | MC56593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 142 ± 23 aa |
| Standard deviation of domain lengths | 23.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520K8A3 | 42-164 | EYEKVTENASGPPVITTYGKIPEFENEEQIRDWLNNLDEIRKGVRSEMRPYFYPEGIVVGCGYHYDGYMSISFEKDIVVEKPLMDEI… |
| A0A0E3L165 | 19-141 | VITKYGKLPELETENQKESWDSTLEELGNKMKDTLASRYMYPHGEVVTCGANAEGYFVILFQYGNVDEPLMNEIYVLVDNAAKEMDI… |
| A0A2I0P9I4 | 31-173 | None |
| A0A099T275 | 120-224 | None |
| A0A0F7IJ25 | 19-152 | None |
| A0A0E3QKS5 | 394-533 | None |
| A0A0E3QX26 | 102-242 | None |
| A0A7Z7AYX1 | 144-271 | None |
| A0A7Z8KMW0 | 22-154 | None |
| L0HHZ9 | 30-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.