DPCstruct | MC56584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 309 |
|---|---|
| Mean domain length (aa) | 167 ± 36 aa |
| Standard deviation of domain lengths | 36.02 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.89 |
| Pfam Score | 92.75 |
| Assigned Pfam label(s) | CL0020- PF00484- PF20393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0VQZ9 | 13-170 | YVICGCSDARVPETTILGCQPGDVFVHRNIANLLSPQDDSLNAVLMVALMNFKVKHIVVTGHTNCVGCLTALNVSRLPPSPPTTPLQ… |
| A0A173LZ50 | 280-498 | NDQLVAKTKSALSRFGFGSNSLVATSFCSDEVNRPLETDFAKEFKDTFSLGGLAGFPFSGVTGFGAMAKHIPDGGSCLVVYGPHVGV… |
| A0A835JCD8 | 79-280 | None |
| A0A1C5H7S4 | 15-174 | None |
| A0A7C3RQE2 | 42-217 | None |
| A0A3A5AHQ8 | 12-232 | None |
| A0A0D2ML49 | 14-160 | None |
| A0A1G0HWY9 | 444-617 | None |
| A0A5N6G4I6 | 4-152 | None |
| A0A2T2X547 | 17-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.