DPCstruct | MC56583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 164 |
|---|---|
| Mean domain length (aa) | 167 ± 31 aa |
| Standard deviation of domain lengths | 31.32 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.54 |
| Pfam Score | 87.55 |
| Assigned Pfam label(s) | PF07500- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0VD43 | 9-145 | SSEGGSVDNVRDKCVVMIYDALALDSTAERAIGIERAANKSMNFSTGNDYRAKMRSLFLNLKDKGNPALRNEIVLGYISTEKVASMS… |
| A0A423U1B4 | 66-185 | APPTTDALRLKCREMLTNALKCSELPDGIVDTPESLGEQIEEAIYQEYRNTDAAYKNRLRSRVYNLKDSKNPQLRENVLRGVISPKR… |
| A0A5D2K0Y4 | 319-448 | None |
| A0A212CDK9 | 80-265 | None |
| L1LAH2 | 6-194 | None |
| B6ACI6 | 4-160 | None |
| A0A835RHA2 | 2-141 | None |
| C1DYW1 | 12-178 | None |
| A0A383W6S4 | 529-725 | None |
| A0A372QNJ9 | 19-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.