DPCstruct | MC5658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 200 ± 31 aa |
| Standard deviation of domain lengths | 30.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M8VQN2 | 35-223 | VTPQTDALYVSMLFHKMAGFQPDFKTWIENSKEYKQTPKQQQRTYMNERTDIYHDYYARLKVDDPIVVQVKTYVPPYDREHGGFQIE… |
| A0A377H5Q8 | 8-189 | LNHFERFTTSVAADYLAIFSPKEYQLYQNDEFERPRLIAKAEEDLFAKLKQQKEPQVFSSVIHSRFGEYDFDKKAFDFQPLKNISAS… |
| A0A5N7WB54 | 79-265 | None |
| A0A5V3GJ24 | 1-208 | None |
| A0A2E1BFA1 | 21-204 | None |
| A0A2G2QHY7 | 158-332 | None |
| A0A2G2LU95 | 27-230 | None |
| A0A4S5C6S8 | 14-239 | None |
| A0A524BN96 | 25-218 | None |
| A0A127CNV5 | 11-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.