DPCstruct | MC5657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 71 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 63.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02935 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7Z3T8 | 2-51 | SSPYHYPEGPRSNLPFNPLTRFFWLRYWGFMAAGFGAPFGIAVWQMKKNV |
| A0A7T7BM38 | 24-95 | SSAIRARMATSFAARRGFSTSRTQLASPYHYPEGPRSNIPFNPLTKYFFWRYWGFMITGFGAPFAIAVWQTY |
| H1V4B3 | 21-105 | None |
| A0A4U7ALM7 | 30-105 | None |
| J3NTA3 | 96-170 | None |
| A0A3D8Q5P7 | 4-70 | None |
| A0A4Q4S442 | 14-87 | None |
| A0A5N5PS21 | 2-63 | None |
| A0A5C6T113 | 111-188 | None |
| A0A6V8HCW8 | 3-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.