DPCstruct | MC56567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 131 ± 15 aa |
| Standard deviation of domain lengths | 15.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536T4T4 | 17-125 | EAIIADACLKGLLMLQLHPPTLVSLAGERPVASAVSRWQAGRGVWVTNLWHETIQVRDQAALRLLTLLDGSRTRTEIATAMADVLPA… |
| A0A258X9U5 | 147-261 | LSQITTDPALLRVIVQLCSEWYVNLHPGPAPFPVAPSDLPCSGPLVRGMLELGEVTLCTMNHSVLKIEQPELRALLMAADGTRSVAE… |
| A0A263HBX1 | 26-184 | None |
| A0A4Q0Q6I4 | 106-241 | None |
| A0A7C4XUJ8 | 266-418 | None |
| A0A7C4UI79 | 814-955 | None |
| A0A6N7PUU9 | 656-762 | None |
| A0A0A1FD09 | 2-132 | None |
| A0A353CDQ1 | 40-158 | None |
| A0A661D1R7 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.